MAP3K10,MEKK10,MLK2
  • MAP3K10,MEKK10,MLK2

Anti-MAP3K10 Antibody 100ul

Ref: AN-HPA007039-100ul
Anti-MAP3K10

Información del producto

Polyclonal Antibody against Human MAP3K10, Gene description: mitogen-activated protein kinase kinase kinase 10, Alternative Gene Names: MEKK10, MLK2, MST, Validated applications: ICC, IHC, Uniprot ID: Q02779, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAP3K10
Gene Description mitogen-activated protein kinase kinase kinase 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSS
Immunogen LPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MEKK10, MLK2, MST
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q02779
HTS Code 3002150000
Gene ID 4294
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAP3K10 Antibody 100ul

Anti-MAP3K10 Antibody 100ul