LITAF,FLJ38636,PIG7
  • LITAF,FLJ38636,PIG7

Anti-LITAF Antibody 25ul

Ref: AN-HPA006960-25ul
Anti-LITAF

Información del producto

Polyclonal Antibody against Human LITAF, Gene description: lipopolysaccharide-induced TNF factor, Alternative Gene Names: FLJ38636, PIG7, SIMPLE, TP53I7, Validated applications: ICC, IHC, WB, Uniprot ID: Q99732, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LITAF
Gene Description lipopolysaccharide-induced TNF factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence APPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNC
Immunogen APPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ38636, PIG7, SIMPLE, TP53I7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99732
HTS Code 3002150000
Gene ID 9516
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LITAF Antibody 25ul

Anti-LITAF Antibody 25ul