PTPRN2,IA-2beta
  • PTPRN2,IA-2beta

Anti-PTPRN2 Antibody 25ul

Ref: AN-HPA006900-25ul
Anti-PTPRN2

Información del producto

Polyclonal Antibody against Human PTPRN2, Gene description: protein tyrosine phosphatase, receptor type, N polypeptide 2, Alternative Gene Names: IA-2beta, ICAAR, KIAA0387, phogrin, Validated applications: ICC, IHC, WB, Uniprot ID: Q92932, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PTPRN2
Gene Description protein tyrosine phosphatase, receptor type, N polypeptide 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence QDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARPLDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGPSKEEQSLPAGAQ
Immunogen QDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARPLDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGPSKEEQSLPAGAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IA-2beta, ICAAR, KIAA0387, phogrin
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92932
HTS Code 3002150000
Gene ID 5799
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PTPRN2 Antibody 25ul

Anti-PTPRN2 Antibody 25ul