ZBTB7B,c-Krox
  • ZBTB7B,c-Krox

Anti-ZBTB7B Antibody 100ul

Ref: AN-HPA006811-100ul
Anti-ZBTB7B

Información del producto

Polyclonal Antibody against Human ZBTB7B, Gene description: zinc finger and BTB domain containing 7B, Alternative Gene Names: c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B, Validated applications: ICC, IHC, Uniprot ID: O15156, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZBTB7B
Gene Description zinc finger and BTB domain containing 7B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKII
Immunogen AHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15156
HTS Code 3002150000
Gene ID 51043
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZBTB7B Antibody 100ul

Anti-ZBTB7B Antibody 100ul