DRAP1,NC2-alpha
  • DRAP1,NC2-alpha

Anti-DRAP1 Antibody 100ul

Ref: AN-HPA006790-100ul
Anti-DRAP1

Información del producto

Polyclonal Antibody against Human DRAP1, Gene description: DR1-associated protein 1 (negative cofactor 2 alpha), Alternative Gene Names: NC2-alpha, Validated applications: ICC, IHC, WB, Uniprot ID: Q14919, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DRAP1
Gene Description DR1-associated protein 1 (negative cofactor 2 alpha)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQ
Immunogen RIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NC2-alpha
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14919
HTS Code 3002150000
Gene ID 10589
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DRAP1 Antibody 100ul

Anti-DRAP1 Antibody 100ul