TSC22D4,THG-1,TILZ2
  • TSC22D4,THG-1,TILZ2

Anti-TSC22D4 Antibody 25ul

Ref: AN-HPA006757-25ul
Anti-TSC22D4

Información del producto

Polyclonal Antibody against Human TSC22D4, Gene description: TSC22 domain family, member 4, Alternative Gene Names: THG-1, TILZ2, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y3Q8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSC22D4
Gene Description TSC22 domain family, member 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence TPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMF
Immunogen TPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names THG-1, TILZ2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3Q8
HTS Code 3002150000
Gene ID 81628
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TSC22D4 Antibody 25ul

Anti-TSC22D4 Antibody 25ul