CDK9,C-2k,CDC2L4
  • CDK9,C-2k,CDC2L4

Anti-CDK9 Antibody 100ul

Ref: AN-HPA006738-100ul
Anti-CDK9

Información del producto

Polyclonal Antibody against Human CDK9, Gene description: cyclin-dependent kinase 9, Alternative Gene Names: C-2k, CDC2L4, PITALRE, TAK, Validated applications: ICC, IHC, Uniprot ID: P50750, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CDK9
Gene Description cyclin-dependent kinase 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence HQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFE
Immunogen HQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C-2k, CDC2L4, PITALRE, TAK
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P50750
HTS Code 3002150000
Gene ID 1025
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDK9 Antibody 100ul

Anti-CDK9 Antibody 100ul