POLH,RAD30A,XP-V
  • POLH,RAD30A,XP-V

Anti-POLH Antibody 25ul

Ref: AN-HPA006721-25ul
Anti-POLH

Información del producto

Polyclonal Antibody against Human POLH, Gene description: polymerase (DNA directed), eta, Alternative Gene Names: RAD30A, XP-V, Validated applications: ICC, IHC, Uniprot ID: Q9Y253, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name POLH
Gene Description polymerase (DNA directed), eta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQKAAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTE
Immunogen PPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQKAAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RAD30A, XP-V
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y253
HTS Code 3002150000
Gene ID 5429
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-POLH Antibody 25ul

Anti-POLH Antibody 25ul