ZKSCAN1,KOX18
  • ZKSCAN1,KOX18

Anti-ZKSCAN1 Antibody 100ul

Ref: AN-HPA006672-100ul
Anti-ZKSCAN1

Información del producto

Polyclonal Antibody against Human ZKSCAN1, Gene description: zinc finger with KRAB and SCAN domains 1, Alternative Gene Names: KOX18, PHZ-37, ZNF139, ZNF36, ZSCAN33, Validated applications: ICC, IHC, WB, Uniprot ID: P17029, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZKSCAN1
Gene Description zinc finger with KRAB and SCAN domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR
Immunogen NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KOX18, PHZ-37, ZNF139, ZNF36, ZSCAN33
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P17029
HTS Code 3002150000
Gene ID 7586
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZKSCAN1 Antibody 100ul

Anti-ZKSCAN1 Antibody 100ul