TAF6,MGC:8964,TAF2E
  • TAF6,MGC:8964,TAF2E

Anti-TAF6 Antibody 100ul

Ref: AN-HPA006566-100ul
Anti-TAF6

Información del producto

Polyclonal Antibody against Human TAF6, Gene description: TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa, Alternative Gene Names: MGC:8964, TAF2E, TAFII70, TAFII80, TAFII85, Validated applications: ICC, IHC, WB, Uniprot ID: P49848, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TAF6
Gene Description TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPG
Immunogen LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC:8964, TAF2E, TAFII70, TAFII80, TAFII85
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49848
HTS Code 3002150000
Gene ID 6878
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TAF6 Antibody 100ul

Anti-TAF6 Antibody 100ul