ARPC3,ARC21,p21-Arc
  • ARPC3,ARC21,p21-Arc

Anti-ARPC3 Antibody 100ul

Ref: AN-HPA006550-100ul
Anti-ARPC3

Información del producto

Polyclonal Antibody against Human ARPC3, Gene description: actin related protein 2/3 complex, subunit 3, 21kDa, Alternative Gene Names: ARC21, p21-Arc, Validated applications: IHC, WB, Uniprot ID: O15145, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARPC3
Gene Description actin related protein 2/3 complex, subunit 3, 21kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSK
Immunogen DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARC21, p21-Arc
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15145
HTS Code 3002150000
Gene ID 10094
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARPC3 Antibody 100ul

Anti-ARPC3 Antibody 100ul