PFDN1,PFD1
  • PFDN1,PFD1

Anti-PFDN1 Antibody 25ul

Ref: AN-HPA006499-25ul
Anti-PFDN1

Información del producto

Polyclonal Antibody against Human PFDN1, Gene description: prefoldin subunit 1, Alternative Gene Names: PFD1, Validated applications: ICC, IHC, Uniprot ID: O60925, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PFDN1
Gene Description prefoldin subunit 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRA
Immunogen ELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PFD1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60925
HTS Code 3002150000
Gene ID 5201
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PFDN1 Antibody 25ul

Anti-PFDN1 Antibody 25ul