CNOT3,KIAA0691
  • CNOT3,KIAA0691

Anti-CNOT3 Antibody 100ul

Ref: AN-HPA006408-100ul
Anti-CNOT3

Información del producto

Polyclonal Antibody against Human CNOT3, Gene description: CCR4-NOT transcription complex, subunit 3, Alternative Gene Names: KIAA0691, LENG2, NOT3, NOT3H, Validated applications: ICC, IHC, WB, Uniprot ID: O75175, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CNOT3
Gene Description CCR4-NOT transcription complex, subunit 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence TPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSA
Immunogen TPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0691, LENG2, NOT3, NOT3H
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75175
HTS Code 3002150000
Gene ID 4849
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CNOT3 Antibody 100ul

Anti-CNOT3 Antibody 100ul