PPP1R13B,ASPP1
  • PPP1R13B,ASPP1

Anti-PPP1R13B Antibody 25ul

Ref: AN-HPA006394-25ul
Anti-PPP1R13B

Información del producto

Polyclonal Antibody against Human PPP1R13B, Gene description: protein phosphatase 1, regulatory subunit 13B, Alternative Gene Names: ASPP1, KIAA0771, p53BP2-like, p85, Validated applications: ICC, IHC, WB, Uniprot ID: Q96KQ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPP1R13B
Gene Description protein phosphatase 1, regulatory subunit 13B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, ICC, WB
Sequence PNIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAPLPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEAPSPGEEQVPPAPLPPASHPPATSTNK
Immunogen PNIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAPLPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEAPSPGEEQVPPAPLPPASHPPATSTNK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ASPP1, KIAA0771, p53BP2-like, p85
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96KQ4
HTS Code 3002150000
Gene ID 23368
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPP1R13B Antibody 25ul

Anti-PPP1R13B Antibody 25ul