POLRMT,APOLMT
  • POLRMT,APOLMT

Anti-POLRMT Antibody 25ul

Ref: AN-HPA006366-25ul
Anti-POLRMT

Información del producto

Polyclonal Antibody against Human POLRMT, Gene description: polymerase (RNA) mitochondrial (DNA directed), Alternative Gene Names: APOLMT, h-mtRPOL, MTRNAP, MTRPOL, Validated applications: ICC, IHC, Uniprot ID: O00411, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name POLRMT
Gene Description polymerase (RNA) mitochondrial (DNA directed)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH
Immunogen ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APOLMT, h-mtRPOL, MTRNAP, MTRPOL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00411
HTS Code 3002150000
Gene ID 5442
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-POLRMT Antibody 25ul

Anti-POLRMT Antibody 25ul