PCK1,PEPCK-C
  • PCK1,PEPCK-C

Anti-PCK1 Antibody 100ul

Ref: AN-HPA006277-100ul
Anti-PCK1

Información del producto

Polyclonal Antibody against Human PCK1, Gene description: phosphoenolpyruvate carboxykinase 1 (soluble), Alternative Gene Names: PEPCK-C, Validated applications: IHC, WB, Uniprot ID: P35558, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCK1
Gene Description phosphoenolpyruvate carboxykinase 1 (soluble)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence KVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSM
Immunogen KVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PEPCK-C
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35558
HTS Code 3002150000
Gene ID 5105
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PCK1 Antibody 100ul

Anti-PCK1 Antibody 100ul