GLCCI1,FAM117C
  • GLCCI1,FAM117C

Anti-GLCCI1 Antibody 100ul

Ref: AN-HPA005987-100ul
Anti-GLCCI1

Información del producto

Polyclonal Antibody against Human GLCCI1, Gene description: glucocorticoid induced transcript 1, Alternative Gene Names: FAM117C, GIG18, TSSN1, Validated applications: IHC, Uniprot ID: Q86VQ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GLCCI1
Gene Description glucocorticoid induced transcript 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SSSPERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDR
Immunogen SSSPERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM117C, GIG18, TSSN1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86VQ1
HTS Code 3002150000
Gene ID 113263
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GLCCI1 Antibody 100ul

Anti-GLCCI1 Antibody 100ul