WASL,N-WASP,NWASP
  • WASL,N-WASP,NWASP

Anti-WASL Antibody 25ul

Ref: AN-HPA005750-25ul
Anti-WASL

Información del producto

Polyclonal Antibody against Human WASL, Gene description: Wiskott-Aldrich syndrome-like, Alternative Gene Names: N-WASP, NWASP, Validated applications: ICC, IHC, WB, Uniprot ID: O00401, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WASL
Gene Description Wiskott-Aldrich syndrome-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
Immunogen DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names N-WASP, NWASP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00401
HTS Code 3002150000
Gene ID 8976
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WASL Antibody 25ul

Anti-WASL Antibody 25ul