ZBTB33,kaiso
  • ZBTB33,kaiso

Anti-ZBTB33 Antibody 25ul

Ref: AN-HPA005732-25ul
Anti-ZBTB33

Información del producto

Polyclonal Antibody against Human ZBTB33, Gene description: zinc finger and BTB domain containing 33, Alternative Gene Names: kaiso, WUGSC:H_DJ525N14.1, ZNF-kaiso, ZNF348, Validated applications: ICC, IHC, Uniprot ID: Q86T24, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZBTB33
Gene Description zinc finger and BTB domain containing 33
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SSSPDSAVSNTSLVPQADTSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGVGSKHLMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDEGEARLEN
Immunogen SSSPDSAVSNTSLVPQADTSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGVGSKHLMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDEGEARLEN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names kaiso, WUGSC:H_DJ525N14.1, ZNF-kaiso, ZNF348
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86T24
HTS Code 3002150000
Gene ID 10009
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZBTB33 Antibody 25ul

Anti-ZBTB33 Antibody 25ul