HIVEP3,FLJ16752
  • HIVEP3,FLJ16752

Anti-HIVEP3 Antibody 25ul

Ref: AN-HPA005728-25ul
Anti-HIVEP3

Información del producto

Polyclonal Antibody against Human HIVEP3, Gene description: human immunodeficiency virus type I enhancer binding protein 3, Alternative Gene Names: FLJ16752, KBP-1, KBP1, KIAA1555, KRC, Schnurri-3, SHN3, ZAS3, ZNF40C, Validated applications: ICC, Uniprot ID: Q5T1R4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HIVEP3
Gene Description human immunodeficiency virus type I enhancer binding protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL
Immunogen SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ16752, KBP-1, KBP1, KIAA1555, KRC, Schnurri-3, SHN3, ZAS3, ZNF40C
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T1R4
HTS Code 3002150000
Gene ID 59269
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HIVEP3 Antibody 25ul

Anti-HIVEP3 Antibody 25ul