FOXJ1,FKHL13,HFH-4
  • FOXJ1,FKHL13,HFH-4

Anti-FOXJ1 Antibody 25ul

Ref: AN-HPA005714-25ul
Anti-FOXJ1

Información del producto

Polyclonal Antibody against Human FOXJ1, Gene description: forkhead box J1, Alternative Gene Names: FKHL13, HFH-4, HFH4, Validated applications: IHC, Uniprot ID: Q92949, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FOXJ1
Gene Description forkhead box J1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Immunogen PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKHL13, HFH-4, HFH4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92949
HTS Code 3002150000
Gene ID 2302
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FOXJ1 Antibody 25ul

Anti-FOXJ1 Antibody 25ul