PRELID1,CGI-106
  • PRELID1,CGI-106

Anti-PRELID1 Antibody 25ul

Ref: AN-HPA005701-25ul
Anti-PRELID1

Información del producto

Polyclonal Antibody against Human PRELID1, Gene description: PRELI domain containing 1, Alternative Gene Names: CGI-106, PRELI, PX19, Validated applications: ICC, IHC, Uniprot ID: Q9Y255, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PRELID1
Gene Description PRELI domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence VAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKA
Immunogen VAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-106, PRELI, PX19
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y255
HTS Code 3002150000
Gene ID 27166
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PRELID1 Antibody 25ul

Anti-PRELID1 Antibody 25ul