NDUFB5,CI-SGDH
  • NDUFB5,CI-SGDH

Anti-NDUFB5 Antibody 25ul

Ref: AN-HPA005640-25ul
Anti-NDUFB5

Información del producto

Polyclonal Antibody against Human NDUFB5, Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa, Alternative Gene Names: CI-SGDH, MGC12314, SGDH, Validated applications: ICC, IHC, WB, Uniprot ID: O43674, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NDUFB5
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Immunogen EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CI-SGDH, MGC12314, SGDH
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43674
HTS Code 3002150000
Gene ID 4711
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDUFB5 Antibody 25ul

Anti-NDUFB5 Antibody 25ul