BIRC2,API1,c-IAP1
  • BIRC2,API1,c-IAP1

Anti-BIRC2 Antibody 100ul

Ref: AN-HPA005513-100ul
Anti-BIRC2

Información del producto

Polyclonal Antibody against Human BIRC2, Gene description: baculoviral IAP repeat containing 2, Alternative Gene Names: API1, c-IAP1, cIAP1, hiap-2, MIHB, RNF48, Validated applications: IHC, WB, Uniprot ID: Q13490, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BIRC2
Gene Description baculoviral IAP repeat containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC
Sequence NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF
Immunogen NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names API1, c-IAP1, cIAP1, hiap-2, MIHB, RNF48
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13490
HTS Code 3002150000
Gene ID 329
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BIRC2 Antibody 100ul

Anti-BIRC2 Antibody 100ul