TPX2,C20orf1
  • TPX2,C20orf1

Anti-TPX2 Antibody 100ul

Ref: AN-HPA005487-100ul
Anti-TPX2

Información del producto

Polyclonal Antibody against Human TPX2, Gene description: TPX2, microtubule-associated, Alternative Gene Names: C20orf1, C20orf2, DIL-2, p100, Validated applications: ICC, IHC, WB, Uniprot ID: Q9ULW0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TPX2
Gene Description TPX2, microtubule-associated
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD
Immunogen QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf1, C20orf2, DIL-2, p100
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULW0
HTS Code 3002150000
Gene ID 22974
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TPX2 Antibody 100ul

Anti-TPX2 Antibody 100ul