PSMC4,MGC13687
  • PSMC4,MGC13687

Anti-PSMC4 Antibody 100ul

Ref: AN-HPA005471-100ul
Anti-PSMC4

Información del producto

Polyclonal Antibody against Human PSMC4, Gene description: proteasome (prosome, macropain) 26S subunit, ATPase, 4, Alternative Gene Names: MGC13687, MGC23214, MGC8570, MIP224, S6, TBP-7, TBP7, Validated applications: IHC, Uniprot ID: P43686, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PSMC4
Gene Description proteasome (prosome, macropain) 26S subunit, ATPase, 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLEL
Immunogen LTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC13687, MGC23214, MGC8570, MIP224, S6, TBP-7, TBP7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P43686
HTS Code 3002150000
Gene ID 5704
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PSMC4 Antibody 100ul

Anti-PSMC4 Antibody 100ul