CBX3,HP1Hs-gamma
  • CBX3,HP1Hs-gamma

Anti-CBX3 Antibody 100ul

Ref: AN-HPA004902-100ul
Anti-CBX3

Información del producto

Polyclonal Antibody against Human CBX3, Gene description: chromobox homolog 3, Alternative Gene Names: HP1Hs-gamma, Validated applications: ICC, IHC, WB, Uniprot ID: Q13185, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CBX3
Gene Description chromobox homolog 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEA
Immunogen RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HP1Hs-gamma
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13185
HTS Code 3002150000
Gene ID 11335
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CBX3 Antibody 100ul

Anti-CBX3 Antibody 100ul