CT83,CXorf61
  • CT83,CXorf61

Anti-CT83 Antibody 100ul

Ref: AN-HPA004773-100ul
Anti-CT83

Información del producto

Polyclonal Antibody against Human CT83, Gene description: cancer/testis antigen 83, Alternative Gene Names: CXorf61, FLJ20611, FLJ22913, KK-LC-1, Validated applications: IHC, Uniprot ID: Q5H943, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CT83
Gene Description cancer/testis antigen 83
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Immunogen QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CXorf61, FLJ20611, FLJ22913, KK-LC-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5H943
HTS Code 3002150000
Gene ID 203413
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CT83 Antibody 100ul

Anti-CT83 Antibody 100ul