ILKAP,DKFZP434J2031
  • ILKAP,DKFZP434J2031

Anti-ILKAP Antibody 25ul

Ref: AN-HPA004752-25ul
Anti-ILKAP

Información del producto

Polyclonal Antibody against Human ILKAP, Gene description: integrin-linked kinase-associated serine/threonine phosphatase, Alternative Gene Names: DKFZP434J2031, FLJ10181, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H0C8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ILKAP
Gene Description integrin-linked kinase-associated serine/threonine phosphatase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications ICC, IHC, WB
Sequence PLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMVKTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHV
Immunogen PLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMVKTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434J2031, FLJ10181
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0C8
HTS Code 3002150000
Gene ID 80895
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ILKAP Antibody 25ul

Anti-ILKAP Antibody 25ul