FLNB,ABP-278,FH1
  • FLNB,ABP-278,FH1

Anti-FLNB Antibody 100ul

Ref: AN-HPA004747-100ul
Anti-FLNB

Información del producto

Polyclonal Antibody against Human FLNB, Gene description: filamin B, beta, Alternative Gene Names: ABP-278, FH1, FLN1L, LRS1, TABP, TAP, Validated applications: ICC, IHC, WB, Uniprot ID: O75369, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FLNB
Gene Description filamin B, beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence KEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWG
Immunogen KEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABP-278, FH1, FLN1L, LRS1, TABP, TAP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75369
HTS Code 3002150000
Gene ID 2317
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FLNB Antibody 100ul

Anti-FLNB Antibody 100ul