ARHGEF7,BETA-PIX
  • ARHGEF7,BETA-PIX

Anti-ARHGEF7 Antibody 25ul

Ref: AN-HPA004744-25ul
Anti-ARHGEF7

Información del producto

Polyclonal Antibody against Human ARHGEF7, Gene description: Rho guanine nucleotide exchange factor (GEF) 7, Alternative Gene Names: BETA-PIX, COOL1, DKFZp686C12170, DKFZp761K1021, KIAA0142, Nbla10314, P50, P50BP, P85, P85COOL1, P85SPR, PAK3, PIXB, Validated applications: IHC, WB, Uniprot ID: Q14155, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARHGEF7
Gene Description Rho guanine nucleotide exchange factor (GEF) 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
Immunogen RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BETA-PIX, COOL1, DKFZp686C12170, DKFZp761K1021, KIAA0142, Nbla10314, P50, P50BP, P85, P85COOL1, P85SPR, PAK3, PIXB
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14155
HTS Code 3002150000
Gene ID 8874
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARHGEF7 Antibody 25ul

Anti-ARHGEF7 Antibody 25ul