MAGEC1,CT7,CT7.1
  • MAGEC1,CT7,CT7.1

Anti-MAGEC1 Antibody 25ul

Ref: AN-HPA004622-25ul
Anti-MAGEC1

Información del producto

Polyclonal Antibody against Human MAGEC1, Gene description: melanoma antigen family C, 1, Alternative Gene Names: CT7, CT7.1, MAGE-C1, MGC39366, Validated applications: IHC, WB, Uniprot ID: O60732, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAGEC1
Gene Description melanoma antigen family C, 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence QIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSALLSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQ
Immunogen QIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSALLSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT7, CT7.1, MAGE-C1, MGC39366
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60732
HTS Code 3002150000
Gene ID 9947
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAGEC1 Antibody 25ul

Anti-MAGEC1 Antibody 25ul