IFITM3,1-8U
  • IFITM3,1-8U

Anti-IFITM3 Antibody 25ul

Ref: AN-HPA004337-25ul
Anti-IFITM3

Información del producto

Polyclonal Antibody against Human IFITM3, Gene description: interferon induced transmembrane protein 3, Alternative Gene Names: 1-8U, Validated applications: IHC, WB, Uniprot ID: Q01628, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IFITM3
Gene Description interferon induced transmembrane protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH
Immunogen MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 1-8U
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q01628
HTS Code 3002150000
Gene ID 10410
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IFITM3 Antibody 25ul

Anti-IFITM3 Antibody 25ul