NR3C1,GR,GRL
  • NR3C1,GR,GRL

Anti-NR3C1 Antibody 25ul

Ref: AN-HPA004248-25ul
Anti-NR3C1

Información del producto

Polyclonal Antibody against Human NR3C1, Gene description: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor), Alternative Gene Names: GR, GRL, Validated applications: ICC, WB, Uniprot ID: P04150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NR3C1
Gene Description nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
Immunogen DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GR, GRL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P04150
HTS Code 3002150000
Gene ID 2908
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NR3C1 Antibody 25ul

Anti-NR3C1 Antibody 25ul