Ver mas grande
Anti-TNFRSF1A Antibody 100ul
AN-HPA004102-100ul
Producto nuevo
Anti-TNFRSF1A
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100ul |
| Gene Name | TNFRSF1A |
| Gene Description | tumor necrosis factor receptor superfamily, member 1A |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | IHC, WB |
| Sequence | GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC |
| Immunogen | GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60 |
| Categoria | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | P19438 |
| HTS Code | 3002150000 |
| Gene ID | 7132 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | IHC, WB |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human TNFRSF1A, Gene description: tumor necrosis factor receptor superfamily, member 1A, Alternative Gene Names: CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60, Validated applications: IHC, WB, Uniprot ID: P19438, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF