DYNLT3,TCTE1L
  • DYNLT3,TCTE1L

Anti-DYNLT3 Antibody 100ul

Ref: AN-HPA003938-100ul
Anti-DYNLT3

Información del producto

Polyclonal Antibody against Human DYNLT3, Gene description: dynein, light chain, Tctex-type 3, Alternative Gene Names: TCTE1L, TCTEX1L, Validated applications: IHC, WB, Uniprot ID: P51808, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DYNLT3
Gene Description dynein, light chain, Tctex-type 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC
Sequence DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE
Immunogen DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TCTE1L, TCTEX1L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51808
HTS Code 3002150000
Gene ID 6990
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DYNLT3 Antibody 100ul

Anti-DYNLT3 Antibody 100ul