UBE2D2,UBC4,UbcH5B
  • UBE2D2,UBC4,UbcH5B

Anti-UBE2D2 Antibody 100ul

Ref: AN-HPA003920-100ul
Anti-UBE2D2

Información del producto

Polyclonal Antibody against Human UBE2D2, Gene description: ubiquitin-conjugating enzyme E2D 2, Alternative Gene Names: UBC4, UbcH5B, Validated applications: ICC, IHC, WB, Uniprot ID: P62837, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBE2D2
Gene Description ubiquitin-conjugating enzyme E2D 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS
Immunogen LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names UBC4, UbcH5B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P62837
HTS Code 3002150000
Gene ID 7322
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UBE2D2 Antibody 100ul

Anti-UBE2D2 Antibody 100ul