CHST7,C6ST-2,C6ST2
  • CHST7,C6ST-2,C6ST2

Anti-CHST7 Antibody 25ul

Ref: AN-HPA003919-25ul
Anti-CHST7

Información del producto

Polyclonal Antibody against Human CHST7, Gene description: carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7, Alternative Gene Names: C6ST-2, C6ST2, Validated applications: IHC, Uniprot ID: Q9NS84, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CHST7
Gene Description carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQL
Immunogen PMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6ST-2, C6ST2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NS84
HTS Code 3002150000
Gene ID 56548
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHST7 Antibody 25ul

Anti-CHST7 Antibody 25ul