UBE2B,HHR6B,RAD6B
  • UBE2B,HHR6B,RAD6B

Anti-UBE2B Antibody 100ul

Ref: AN-HPA003875-100ul
Anti-UBE2B

Información del producto

Polyclonal Antibody against Human UBE2B, Gene description: ubiquitin-conjugating enzyme E2B, Alternative Gene Names: HHR6B, RAD6B, UBC2, Validated applications: ICC, Uniprot ID: P63146, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBE2B
Gene Description ubiquitin-conjugating enzyme E2B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQ
Immunogen LMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HHR6B, RAD6B, UBC2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P63146
HTS Code 3002150000
Gene ID 7320
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UBE2B Antibody 100ul

Anti-UBE2B Antibody 100ul