MIF,GIF,GLIF
  • MIF,GIF,GLIF

Anti-MIF Antibody 25ul

Ref: AN-HPA003868-25ul
Anti-MIF

Información del producto

Polyclonal Antibody against Human MIF, Gene description: macrophage migration inhibitory factor (glycosylation-inhibiting factor), Alternative Gene Names: GIF, GLIF, Validated applications: ICC, IHC, WB, Uniprot ID: P14174, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MIF
Gene Description macrophage migration inhibitory factor (glycosylation-inhibiting factor)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNN
Immunogen FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GIF, GLIF
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P14174
HTS Code 3002150000
Gene ID 4282
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MIF Antibody 25ul

Anti-MIF Antibody 25ul