DYNC1H1,DHC1,DNCH1
  • DYNC1H1,DHC1,DNCH1

Anti-DYNC1H1 Antibody 25ul

Ref: AN-HPA003742-25ul
Anti-DYNC1H1

Información del producto

Polyclonal Antibody against Human DYNC1H1, Gene description: dynein, cytoplasmic 1, heavy chain 1, Alternative Gene Names: DHC1, DNCH1, Dnchc1, DNCL, DNECL, HL-3, p22, Validated applications: IHC, Uniprot ID: Q14204, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DYNC1H1
Gene Description dynein, cytoplasmic 1, heavy chain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQR
Immunogen RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DHC1, DNCH1, Dnchc1, DNCL, DNECL, HL-3, p22
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14204
HTS Code 3002150000
Gene ID 1778
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DYNC1H1 Antibody 25ul

Anti-DYNC1H1 Antibody 25ul