RRAGA,FIP-1,RAGA
  • RRAGA,FIP-1,RAGA

Anti-RRAGA Antibody 100ul

Ref: AN-HPA003734-100ul
Anti-RRAGA

Información del producto

Polyclonal Antibody against Human RRAGA, Gene description: Ras-related GTP binding A, Alternative Gene Names: FIP-1, RAGA, Validated applications: ICC, IHC, WB, Uniprot ID: Q7L523, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RRAGA
Gene Description Ras-related GTP binding A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence FDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCF
Immunogen FDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FIP-1, RAGA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L523
HTS Code 3002150000
Gene ID 10670
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RRAGA Antibody 100ul

Anti-RRAGA Antibody 100ul