ZNF3,A8-51,FLJ20216
  • ZNF3,A8-51,FLJ20216

Anti-ZNF3 Antibody 100ul

Ref: AN-HPA003719-100ul
Anti-ZNF3

Información del producto

Polyclonal Antibody against Human ZNF3, Gene description: zinc finger protein 3, Alternative Gene Names: A8-51, FLJ20216, HF.12, KOX25, PP838, Zfp113, Validated applications: ICC, IHC, Uniprot ID: P17036, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF3
Gene Description zinc finger protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications ICC, IHC
Sequence SALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNRK
Immunogen SALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names A8-51, FLJ20216, HF.12, KOX25, PP838, Zfp113
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P17036
HTS Code 3002150000
Gene ID 7551
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF3 Antibody 100ul

Anti-ZNF3 Antibody 100ul