OAS1,IFI-4,OIAS
  • OAS1,IFI-4,OIAS

Anti-OAS1 Antibody 25ul

Ref: AN-HPA003657-25ul
Anti-OAS1

Información del producto

Polyclonal Antibody against Human OAS1, Gene description: 2'-5'-oligoadenylate synthetase 1, 40/46kDa, Alternative Gene Names: IFI-4, OIAS, OIASI, Validated applications: ICC, IHC, Uniprot ID: P00973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name OAS1
Gene Description 2'-5'-oligoadenylate synthetase 1, 40/46kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKK
Immunogen VFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IFI-4, OIAS, OIASI
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P00973
HTS Code 3002150000
Gene ID 4938
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OAS1 Antibody 25ul

Anti-OAS1 Antibody 25ul