PNPLA4,DXS1283E,GS2
  • PNPLA4,DXS1283E,GS2

Anti-PNPLA4 Antibody 100ul

Ref: AN-HPA003656-100ul
Anti-PNPLA4

Información del producto

Polyclonal Antibody against Human PNPLA4, Gene description: patatin-like phospholipase domain containing 4, Alternative Gene Names: DXS1283E, GS2, iPLA2eta, Validated applications: IHC, WB, Uniprot ID: P41247, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PNPLA4
Gene Description patatin-like phospholipase domain containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence QFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLD
Immunogen QFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DXS1283E, GS2, iPLA2eta
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P41247
HTS Code 3002150000
Gene ID 8228
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PNPLA4 Antibody 100ul

Anti-PNPLA4 Antibody 100ul