MAD1L1,HsMAD1,MAD1
  • MAD1L1,HsMAD1,MAD1

Anti-MAD1L1 Antibody 25ul

Ref: AN-HPA003635-25ul
Anti-MAD1L1

Información del producto

Polyclonal Antibody against Human MAD1L1, Gene description: MAD1 mitotic arrest deficient-like 1 (yeast), Alternative Gene Names: HsMAD1, MAD1, PIG9, TP53I9, TXBP181, Validated applications: IHC, WB, Uniprot ID: Q9Y6D9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAD1L1
Gene Description MAD1 mitotic arrest deficient-like 1 (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence TKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLEIRRAPPLSNN
Immunogen TKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLEIRRAPPLSNN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HsMAD1, MAD1, PIG9, TP53I9, TXBP181
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6D9
HTS Code 3002150000
Gene ID 8379
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAD1L1 Antibody 25ul

Anti-MAD1L1 Antibody 25ul