MRPL58,DS-1,ICT1
  • MRPL58,DS-1,ICT1

Anti-MRPL58 Antibody 25ul

Ref: AN-HPA003634-25ul
Anti-MRPL58

Información del producto

Polyclonal Antibody against Human MRPL58, Gene description: mitochondrial ribosomal protein L58, Alternative Gene Names: DS-1, ICT1, Validated applications: IHC, WB, Uniprot ID: Q14197, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPL58
Gene Description mitochondrial ribosomal protein L58
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMI
Immunogen TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DS-1, ICT1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14197
HTS Code 3002150000
Gene ID 3396
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPL58 Antibody 25ul

Anti-MRPL58 Antibody 25ul