P2RY8,P2Y8
  • P2RY8,P2Y8

Anti-P2RY8 Antibody 100ul

Ref: AN-HPA003631-100ul
Anti-P2RY8

Información del producto

Polyclonal Antibody against Human P2RY8, Gene description: purinergic receptor P2Y, G-protein coupled, 8, Alternative Gene Names: P2Y8, Validated applications: IHC, Uniprot ID: Q86VZ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name P2RY8
Gene Description purinergic receptor P2Y, G-protein coupled, 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
Immunogen GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names P2Y8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86VZ1
HTS Code 3002150000
Gene ID 286530
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-P2RY8 Antibody 100ul

Anti-P2RY8 Antibody 100ul