RBM3,IS1-RNPL
  • RBM3,IS1-RNPL

Anti-RBM3 Antibody 25ul

Ref: AN-HPA003624-25ul
Anti-RBM3

Información del producto

Polyclonal Antibody against Human RBM3, Gene description: RNA binding motif (RNP1, RRM) protein 3, Alternative Gene Names: IS1-RNPL, Validated applications: ICC, IHC, WB, Uniprot ID: P98179, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBM3
Gene Description RNA binding motif (RNP1, RRM) protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY
Immunogen DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IS1-RNPL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P98179
HTS Code 3002150000
Gene ID 5935
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBM3 Antibody 25ul

Anti-RBM3 Antibody 25ul