VIPAS39,C14orf133
  • VIPAS39,C14orf133

Anti-VIPAS39 Antibody 25ul

Ref: AN-HPA003593-25ul
Anti-VIPAS39

Información del producto

Polyclonal Antibody against Human VIPAS39, Gene description: VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog, Alternative Gene Names: C14orf133, hSPE-39, SPE-39, SPE39, VIPAR, VPS16B, Validated applications: IHC, Uniprot ID: Q9H9C1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VIPAS39
Gene Description VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEGTFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAPVQILQEYVNLVEDVDTK
Immunogen AHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEGTFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAPVQILQEYVNLVEDVDTK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf133, hSPE-39, SPE-39, SPE39, VIPAR, VPS16B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H9C1
HTS Code 3002150000
Gene ID 63894
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VIPAS39 Antibody 25ul

Anti-VIPAS39 Antibody 25ul